PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00756g01024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YB
Protein Properties Length: 118aa    MW: 13231 Da    PI: 4.944
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00756g01024.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB156.74e-4929118392
                     NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                               eqdr+lPian+srimkk++P+n+ki+kdak+ vqecvsefisf+tseasdkcqre+rkting dll a+  lGfedyv+plk++l
  Peinf101Scf00756g01024.1  29 EQDRLLPIANISRIMKKAIPSNGKIAKDAKDAVQECVSEFISFITSEASDKCQRERRKTINGYDLLLAMLALGFEDYVDPLKMFL 113
                               8************************************************************************************ PP

                     NF-YB  88 kkyre 92 
                                +y e
  Peinf101Scf00756g01024.1 114 DRYTE 118
                               ***76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-4525118IPR009072Histone-fold
SuperFamilySSF471131.71E-3430118IPR009072Histone-fold
PfamPF008081.3E-263397IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-166179No hitNo description
PROSITE patternPS0068506480IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.3E-168098No hitNo description
PRINTSPR006151.3E-1699117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MADDHQGSAN SHESDEHSPP PIGSKNICEQ DRLLPIANIS RIMKKAIPSN GKIAKDAKDA  60
VQECVSEFIS FITSEASDKC QRERRKTING YDLLLAMLAL GFEDYVDPLK MFLDRYTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4329118392Transcription factor HapC (Eurofung)
4g92_B2e-4329118392Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003623108.24e-56nuclear transcription factor Y subunit B, partial
RefseqXP_003625575.15e-56nuclear transcription factor Y subunit B
SwissprotQ5QMG34e-52NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2
TrEMBLA0A0H3UW935e-56A0A0H3UW93_MEDSA; Nuclear factor Y subunit B isoform 3
TrEMBLG7L1Q25e-56G7L1Q2_MEDTR; Nuclear transcription factor Y subunit B
TrEMBLG7L4J25e-56G7L4J2_MEDTR; Nuclear transcription factor Y subunit B (Fragment)
STRINGGLYMA19G36220.24e-54(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2510022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.31e-52nuclear factor Y, subunit B8